PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG009970t2
Common NameTCM_009970
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family HD-ZIP
Protein Properties Length: 303aa    MW: 34115.5 Da    PI: 4.3215
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG009970t2genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.91.7e-1868122357
                       --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
          Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                       k++++t++q++ Le+ Fe ++++  e++ +LAk+lgL+ rqV +WFqNrRa+ k+
  Thecc1EG009970t2  68 KKRRLTATQVQFLERSFEVENKLEPERKVQLAKELGLQPRQVAIWFQNRRARFKN 122
                       56689***********************************************995 PP

2HD-ZIP_I/II126.79.9e-4168157291
       HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                       kkrrl++ qv++LE+sFe e+kLeperKv+la+eLglqprqva+WFqnrRAR+k+kqlEkdy++Lk++yd+lk++ ++L ke+e+L++e+
  Thecc1EG009970t2  68 KKRRLTATQVQFLERSFEVENKLEPERKVQLAKELGLQPRQVAIWFQNRRARFKNKQLEKDYDSLKASYDELKTDYDNLLKEKEDLENEV 157
                       9*************************************************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.54E-1958125IPR009057Homeodomain-like
PROSITE profilePS5007117.44363123IPR001356Homeobox domain
SMARTSM003898.6E-1866127IPR001356Homeobox domain
PfamPF000466.8E-1668121IPR001356Homeobox domain
CDDcd000869.83E-1868124No hitNo description
Gene3DG3DSA:1.10.10.609.4E-2070123IPR009057Homeodomain-like
PRINTSPR000314.5E-694103IPR000047Helix-turn-helix motif
PROSITE patternPS00027098121IPR017970Homeobox, conserved site
PRINTSPR000314.5E-6103119IPR000047Helix-turn-helix motif
PfamPF021831.8E-15123164IPR003106Leucine zipper, homeobox-associated
Gene3DG3DSA:1.20.5.3709.0E-4124159IPR014751DNA repair protein XRCC4, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006302Biological Processdouble-strand break repair
GO:0006310Biological ProcessDNA recombination
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MEGGKICGSS NMNALIHSEQ LSCSSEVMES LWIPSSTSAL RDMLFFQPLD KEESGDDDFH  60
GSYRPPAKKR RLTATQVQFL ERSFEVENKL EPERKVQLAK ELGLQPRQVA IWFQNRRARF  120
KNKQLEKDYD SLKASYDELK TDYDNLLKEK EDLENEVLAL KEKLLNGEEG MENSGSLDAI  180
NSSNAESKKP NCDTSPENVS RVPSPACKQE EACSAKSDVF DSDSPHYTDG NHSSLIEPAD  240
SSNAFEPDQS DFSQDEEDNL SKSLLHPPFF PKFEVDCYYD APASSCNFAL PVEDQSFWSS  300
LY*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1115123RRARFKNKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007044377.10.0Homeobox-leucine zipper protein HAT5, putative isoform 2
TrEMBLA0A061ED870.0A0A061ED87_THECC; Homeobox-leucine zipper protein HAT5, putative isoform 2
STRINGVIT_01s0026g01550.t011e-112(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.17e-39homeobox 1
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]